TB-500 5mg – High-Purity Research Peptide
Gizem Peptides proudly supplies TB-500 5mg, a high-purity, research-grade peptide manufactured under strict quality control standards for laboratory and scientific applications. Designed for wholesale distribution worldwide, this product is ideal for research institutions, biotech companies, peptide laboratories, and authorized distributors seeking consistent quality and reliable supply chains.
Product Overview
TB-500 is supplied as a lyophilised (freeze-dried) solid to ensure maximum stability and long-term preservation during storage and international transport. Each vial is carefully processed and sealed under controlled conditions to maintain structural integrity and peptide purity.
This product is intended strictly for in-vitro laboratory research and analytical purposes only, and is not for human consumption, diagnostic use, or therapeutic application.
Technical Specifications
- Product Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
- Molecular Weight: 4963.4 g/mol
- Amino Acid Sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES - Purity: ≥ 98% (HPLC verified)
- Form: Lyophilised solid (freeze-dried powder)
- Appearance: White to off-white solid cake or powder
- Stability: Stable under recommended storage conditions
Quality Assurance
At Gizem Peptides, every batch of TB-500 undergoes comprehensive analytical testing to ensure exceptional consistency and reliability. Quality control processes include:
- High-Performance Liquid Chromatography (HPLC) purity verification
- Mass spectrometry confirmation of molecular weight
- Sterility and endotoxin screening (where applicable for research standards)
- Batch-specific Certificate of Analysis (COA) available upon request
Our manufacturing partners adhere to stringent laboratory-grade production protocols to ensure reproducibility across all global shipments.
Packaging & Presentation
Each vial of TB-500 5mg is packaged to support international wholesale and retail distribution:
- Sterile, tamper-evident sealed vials
- Vacuum-sealed secondary packaging for transport protection
- Clearly labeled with catalogue number, batch number, and expiry date
- Optional private-label and OEM branding available for distributors
Storage & Stability
To maintain optimal integrity:
- Store at -20°C for long-term storage
- Can be kept refrigerated (2–8°C) for short-term handling
- Protect from light, moisture, and repeated freeze-thaw cycles
- Reconstituted material should be handled according to standard laboratory stability protocols
Wholesale & Global Distribution
Gizem Peptides provides scalable wholesale solutions for global partners, including:
- Bulk order supply options
- International shipping and export support
- Discreet and secure packaging for logistics efficiency
- Flexible distribution agreements for laboratories and resellers
- Fast turnaround times for repeat orders and high-volume clients
We are committed to supporting a dependable global supply chain for research institutions and commercial partners.
Important Notice
This product is supplied strictly for research and development purposes only. It is not intended for human or veterinary use, diagnostic procedures, or therapeutic applications. Buyers are responsible for ensuring compliance with local regulations governing research materials.





Reviews
There are no reviews yet.